Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13B, Human

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TNFRSF13B Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Molecular Formula

23495 (Gene_ID) O14836-1 (M1-V160) (Accession)

Molecular Weight

Approximately 19.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin A1 Antibody / CCNA1
V8293-100UG 100 µg

Cyclin A1 Antibody / CCNA1

Sign In for Pricing
View Details
POU Class 4 Homeobox 3 (POU4F3) Antibody
abx006183-01 20 µL

POU Class 4 Homeobox 3 (POU4F3) Antibody

Sign In for Pricing
View Details
POU Class 4 Homeobox 3 (POU4F3) Antibody
abx006183-02 100 µL

POU Class 4 Homeobox 3 (POU4F3) Antibody

Sign In for Pricing
View Details
POU Class 4 Homeobox 3 (POU4F3) Antibody
abx006183-03 2x 100 µL

POU Class 4 Homeobox 3 (POU4F3) Antibody

Sign In for Pricing
View Details
Rabbit Anti-REG3A antibody
SL10919R-01 50 µL

Rabbit Anti-REG3A antibody

Sign In for Pricing
View Details
Rabbit Anti-REG3A antibody
SL10919R-02 100 µL

Rabbit Anti-REG3A antibody

Sign In for Pricing
View Details