TNFRSF13B, Human
TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TNFRSF13B Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
Molecular Formula
23495 (Gene_ID) O14836-1 (M1-V160) (Accession)
Molecular Weight
Approximately 19.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1602182 100 µL
Phospho-IRS1 (Tyr1179) Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details 
K6687307 1.0 µg DNA
Tfap2d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 