Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13B, Human

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TNFRSF13B Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Molecular Formula

23495 (Gene_ID) O14836-1 (M1-V160) (Accession)

Molecular Weight

Approximately 19.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPG5B CRISPRa sgRNA lentivector (set of three targets)(Human)
45308121 3x 1.0µg DNA

SPG5B CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)
373419-01 20 µg

GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)

Ask
View Details
GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)
373419-02 100 µg

GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)

Ask
View Details
GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)
373419-03 1 mg

GDI2, Recombinant, Human, aa1-441, GST-Tag (Rab GDP Dissociation Inhibitor beta)

Ask
View Details
PTP1B-IN-3 (diammonium)
HY-15133A 1 mg

PTP1B-IN-3 (diammonium)

Ask
View Details
ZNF724P AAV Vector (Human) (CMV)
51771101 1 µg

ZNF724P AAV Vector (Human) (CMV)

Ask
View Details