TNFRSF12A, Human
TNFRSF12A Protein, the receptor for TNFSF12/TWEAK, acts as a weak apoptosis inducer in specific cell types. It also promotes angiogenesis, endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins. Association with TRAF1, TRAF2, and potentially TRAF3 underscores its involvement in diverse cellular signaling pathways. TNFRSF12A Protein, Human is the recombinant human-derived TNFRSF12A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TNFRSF12A Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
95
Smiles
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
Molecular Formula
51330 (Gene_ID) Q9NP84-1 (E28-P80) (Accession)
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YER130C Polyclonal Antibody
Phospho-c-Jun (Thr91+Thr93) Recombinant Antibody, FITC Conjugated