Prokineticin-1/EG-VEGF, Human
Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Prokineticin-1/EG-VEGF Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Molecular Formula
84432 (Gene_ID) P58294 (A20-F105) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
CD45 / LCA (136-4B5), CF647 conjugate, 0.1mg/mL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF568 conjugate, 0.1mg/mL
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
