TECK/CCL25, Mouse
The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TECK/CCL25 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
97.00
Smiles
QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Molecular Formula
20300 (Gene_ID) O35903 (Q24-N144) (Accession)
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
LY6E, ID (LY6E, 9804, RIGE, SCA2, TSA1, Lymphocyte antigen 6E, Retinoic acid-induced gene E protein, Stem cell antigen 2, Thymic shared antigen 1) (MaxLight 405) discontinued
PIC 1212-DIA 315-B7525 Personal Protection (PPE) Signs (No Adhesive)
