Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TECK/CCL25, Mouse

The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TECK/CCL25 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

97.00

Smiles

QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Molecular Formula

20300 (Gene_ID) O35903 (Q24-N144) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-01 0.1 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details
Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-02 0.2 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details
Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-03 0.5 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details
Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-04 1 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details
Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-05 5 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details
Polyclonal Antibody to Neurofibromin 2 (NF2)
MBS2026853-06 5x 5 mL

Polyclonal Antibody to Neurofibromin 2 (NF2)

Ask
View Details