TECK/CCL25, Mouse
The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TECK/CCL25 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
97.00
Smiles
QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Molecular Formula
20300 (Gene_ID) O35903 (Q24-N144) (Accession)
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Interleukin 10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF) (Biotin)
Interleukin 10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF) (Biotin)