CCL21C, Mouse
CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
CCL21C Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
98.00
Smiles
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Molecular Formula
100042493 (Gene_ID) P86793 (S24-G133) (Accession)
Molecular Weight
Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Interleukin 5 (Interleukin-5, IL-5, B Cell Growth Factor II, BCGF-II, Cytotoxic T-lymphocyte Inducer, Eosinophil Differentiation Factor, T-cell Replacing Factor, TRF, Il5) (MaxLight 650) discontinued