CCL21C, Mouse
CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
CCL21C Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
98.00
Smiles
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Molecular Formula
100042493 (Gene_ID) P86793 (S24-G133) (Accession)
Molecular Weight
Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042287-500 1x 500 µL
SOX9 / SRY-box 9 (SOX9/2287R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PB9017-Dylight594 100 µg
Anti-ICAM1 Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 