CCL21C, Mouse
CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
CCL21C Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
98.00
Smiles
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Molecular Formula
100042493 (Gene_ID) P86793 (S24-G133) (Accession)
Molecular Weight
Approximately 10-18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP38352_P050-HRP 100 µL
ZNF202 Antibody - C-terminal region : HRP (ARP38352_P050-HRP)
Sign In for Pricing
View Details 40457141 1x 10^6 Cells / 1.0 mL
RNU6-35 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
GTR15286364 1 Vial
Lentiviral mouse Vat1 shRNA (UAS) - Lentiviral mouseVat1 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 354903-01 48 Tests
COL4A1 (Collagen alpha-1 (IV) chain) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details