Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fractalkine/CX3CL1, Mouse

The Fractalkine/CX3CL1 protein is a multifunctional chemokine that binds to CX3CR1 and the integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune responses, inflammation, cell adhesion, and chemotaxis. Fractalkine/CX3CL1 Protein, Mouse is the recombinant mouse-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Fractalkine/CX3CL1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

96.00

Smiles

QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG

Molecular Formula

20312 (Gene_ID) O35188 (Q25-G100) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF740 conjugate, 0.1mg/mL
BNC742644-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL
BNC402346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details