Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

I-TAC/CXCL11, Mouse

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

I-TAC/CXCL11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

98.00

Smiles

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Molecular Formula

56066 (Gene_ID) Q9JHH5 (F22-M100) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEAK1 Antibody
A74383-100UL 100 µL

PEAK1 Antibody

Sign In for Pricing
View Details
Anti-TRIP/TRAIP Antibody Picoband® (Biotine Conjugate)
A07953-2-Biotin 100 µg/Vial

Anti-TRIP/TRAIP Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
NEXN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV692547 1.0 µg DNA

NEXN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
DOK2 Antibody (Phospho-Tyr299)
OAAN02891-200UL 200 µL

DOK2 Antibody (Phospho-Tyr299)

Sign In for Pricing
View Details
Olr1119 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV633850 1.0 µg DNA

Olr1119 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Agomelatine-d6
441066 1 mg

Agomelatine-d6

Sign In for Pricing
View Details