Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

I-TAC/CXCL11, Mouse

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

I-TAC/CXCL11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

98.00

Smiles

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Molecular Formula

56066 (Gene_ID) Q9JHH5 (F22-M100) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat Shock 70kDa Protein 8 (HSPA8) ELISA Kit
EKU04663 96 Tests

Human Heat Shock 70kDa Protein 8 (HSPA8) ELISA Kit

Sign In for Pricing
View Details
Klk7 Antibody
CSB-PA012458LA01RA-01 50 µg

Klk7 Antibody

Sign In for Pricing
View Details
Klk7 Antibody
CSB-PA012458LA01RA-02 100 µg

Klk7 Antibody

Sign In for Pricing
View Details
Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)
abx317721-01 20 µg

Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)

Sign In for Pricing
View Details
Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)
abx317721-02 50 µg

Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)

Sign In for Pricing
View Details
Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)
abx317721-03 100 µg

Microtubule-Associated Proteins 1A/1B Light Chain 3B (MAP1LC3B) Antibody (Biotin)

Sign In for Pricing
View Details