Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-36 beta/IL-1F8, Human (153a.a)

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP. IL-36 beta/IL-1F8 Protein, Human (153a.a) is the recombinant human-derived IL-36 beta/IL-1F8 protein, expressed by E. coli , with tag free. The total length of IL-36 beta/IL-1F8 Protein, Human (153a.a) is 153 a.a., with molecular weight of ~ 17.2 kDa.

Product Specifications

Product Name Alternative

IL-36 beta/IL-1F8 Protein, Human (153a.a), Human, E. coli

UNSPSC

12352202

Purity

97.00

Smiles

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Molecular Formula

27177 (Gene_ID) Q9NZH7-2 (R5-E157) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDN193189 Hydrochloride
MBS696260-01 5 mg

LDN193189 Hydrochloride

Sign In for Pricing
View Details
LDN193189 Hydrochloride
MBS696260-02 25 mg

LDN193189 Hydrochloride

Sign In for Pricing
View Details
LDN193189 Hydrochloride
MBS696260-03 5x 25 mg

LDN193189 Hydrochloride

Sign In for Pricing
View Details
Anti-SAPAP2 Antibody
CQA4272-01 30 µL

Anti-SAPAP2 Antibody

Sign In for Pricing
View Details
Anti-SAPAP2 Antibody
CQA4272-02 50 μL

Anti-SAPAP2 Antibody

Sign In for Pricing
View Details
Anti-SAPAP2 Antibody
CQA4272-03 100 µL

Anti-SAPAP2 Antibody

Sign In for Pricing
View Details