Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Calbindin (CALB1) ELISA Kit
RK07649 96 Tests

Chicken Calbindin (CALB1) ELISA Kit

Sign In for Pricing
View Details
CDC2L2 Human qPCR Primer Pair (NM_033527)
HP216460 200 Reactions

CDC2L2 Human qPCR Primer Pair (NM_033527)

Sign In for Pricing
View Details
TRNAE18 3'UTR Lenti-reporter-Luc Vector
47984081 1.0 µg

TRNAE18 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Monoclonal TLR2 Antibody (tomaralimab) [Janelia Fluor 585]
NBP3-28707JF585 0.1 mL

Human Monoclonal TLR2 Antibody (tomaralimab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Integrin beta6 (MaxLight 490) discontinued
I7661-44-ML490 100 µL

Integrin beta6 (MaxLight 490) discontinued

Sign In for Pricing
View Details
C20orf194 discontinued
507472 100 µg

C20orf194 discontinued

Sign In for Pricing
View Details