Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40LG Antibody
MBS8517057-01 0.05 mg

CD40LG Antibody

Sign In for Pricing
View Details
CD40LG Antibody
MBS8517057-02 0.1 mg

CD40LG Antibody

Sign In for Pricing
View Details
CD40LG Antibody
MBS8517057-03 0.1 mL (AF750)

CD40LG Antibody

Sign In for Pricing
View Details
CD40LG Antibody
MBS8517057-04 0.1 mL (AF405M)

CD40LG Antibody

Sign In for Pricing
View Details
CD40LG Antibody
MBS8517057-05 0.1 mL (AF546)

CD40LG Antibody

Sign In for Pricing
View Details
CD40LG Antibody
MBS8517057-06 0.1 mL (AF405L)

CD40LG Antibody

Sign In for Pricing
View Details