Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GABPB1 shRNA (UAS) - Lentiviral human GABPB1 shRNA (UAS) (25)
GTR15094073 1 Vial

Lentiviral human GABPB1 shRNA (UAS) - Lentiviral human GABPB1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Monoclonal Ub-K63 Antibody (HWA4C4) [DyLight 755]
NBP2-00199IR 100 µL

Mouse Monoclonal Ub-K63 Antibody (HWA4C4) [DyLight 755]

Sign In for Pricing
View Details
Simian Virus 5 (SV5) Antibody (FITC)
abx414045 0.1 mg

Simian Virus 5 (SV5) Antibody (FITC)

Sign In for Pricing
View Details
MSC sgRNA CRISPR Lentivector (Human) (Target 3)
K1348004 1.0 µg DNA

MSC sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Bovine Uncharacterized protein CXorf64 homolog
MBS1185876-01 0.02 mg (E-Coli)

Recombinant Bovine Uncharacterized protein CXorf64 homolog

Sign In for Pricing
View Details
Recombinant Bovine Uncharacterized protein CXorf64 homolog
MBS1185876-02 0.02 mg (Yeast)

Recombinant Bovine Uncharacterized protein CXorf64 homolog

Sign In for Pricing
View Details