Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [HRP]
NBP3-06377H 0.1 mL

Mouse Monoclonal MST1/STK4 Antibody (1G5H4) [HRP]

Sign In for Pricing
View Details
ZC3HAV1 Rabbit Polyclonal Antibody
TA371994 100 µL

ZC3HAV1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human COL4A6 Protein - (Dry Ice)
H00001288-P02-25ug 25 µg

Recombinant Human COL4A6 Protein - (Dry Ice)

Sign In for Pricing
View Details
Gfra3 Rat shRNA Plasmid (Locus ID 84422)
TR711824 1 Kit

Gfra3 Rat shRNA Plasmid (Locus ID 84422)

Sign In for Pricing
View Details
Fludioxonil
M27345-01 1 g

Fludioxonil

Sign In for Pricing
View Details
Fludioxonil
M27345-02 200 mg

Fludioxonil

Sign In for Pricing
View Details