IL-13, Rat
IL-13 Protein, Rat is a cytokine secreted by many cell types, but especially T helper type 2 (Th2) cells, that is an important mediator of allergic inflammation and disease.
Product Specifications
Product Name Alternative
IL-13 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Purity
98.0
Smiles
TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Molecular Formula
116553 (Gene_ID) P42203 (T19-H131) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Ma Y, et al. Novel recombinant interleukin-13 peptide-based vaccine reduces airway allergic inflammatoryresponses in mice. Am J Respir Crit Care Med. 2007 Sep 1;176 (5) :439-45.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
