Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1a, Mouse (HEK293, His)

Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

99.9

Smiles

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

Molecular Formula

20700 (Gene_ID) AAH11040.1 (E25-K413) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monopentyl Phthalate
TRC-M566740-50MG 50 mg

Monopentyl Phthalate

Sign In for Pricing
View Details
Zomepirac Acyl-O-Beta-D-glucuronide
TRC-Z675010-5MG 5 mg

Zomepirac Acyl-O-Beta-D-glucuronide

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), Biotin conjugate, 0.1mg/mL
BNCB1409-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UNC119 binding protein C5orf30 (C5orf30) (NM_033211) Human Over-expression Lysate
LY403234 100 µg

UNC119 binding protein C5orf30 (C5orf30) (NM_033211) Human Over-expression Lysate

Sign In for Pricing
View Details
MAFB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]
TA800279BM 100 µL

MAFB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]

Sign In for Pricing
View Details
AXL Human Gene Knockout Kit (CRISPR)
KN206431LP 1 Kit

AXL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details