Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1a, Mouse (HEK293, His)

Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

99.9

Smiles

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

Molecular Formula

20700 (Gene_ID) AAH11040.1 (E25-K413) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF568 conjugate, 0.1mg/mL
BNC683175-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OptiWell™ Automation Reservoirs
D3390-96 50 Units/Case

OptiWell™ Automation Reservoirs

Sign In for Pricing
View Details
Snrk Mouse Gene Knockout Kit (CRISPR)
KN516392 1 Kit

Snrk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zuclopenthixol Decanoate
TRC-Z701490-10MG 10 mg

Zuclopenthixol Decanoate

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), 0.2mg/mL
BNUB1869-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), 0.2mg/mL

Sign In for Pricing
View Details
Cdipt Mouse Gene Knockout Kit (CRISPR)
KN503025 1 Kit

Cdipt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details