Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1a, Mouse (HEK293, His)

Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

99.9

Smiles

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

Molecular Formula

20700 (Gene_ID) AAH11040.1 (E25-K413) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1L (NM_198533) Human Over-expression Lysate
LY403686 100 µg

HSD11B1L (NM_198533) Human Over-expression Lysate

Sign In for Pricing
View Details
Siglec 7 (SIGLEC7) Mouse Monoclonal Antibody [Clone ID: 6-434]
AM26779RP-N 100 Tests

Siglec 7 (SIGLEC7) Mouse Monoclonal Antibody [Clone ID: 6-434]

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LmLN2 activation kit by CRISPRa
GA119081 1 Kit

Human LmLN2 activation kit by CRISPRa

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF568 conjugate, 0.1mg/mL
BNC682037-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS641091 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details