Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1a, Mouse (HEK293, His)

Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A1a Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Purity

99.9

Smiles

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

Molecular Formula

20700 (Gene_ID) AAH11040.1 (E25-K413) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

all-trans-13,14-Dihdyro Retinol (>80%)
TRC-D449350-5MG 5 mg

all-trans-13,14-Dihdyro Retinol (>80%)

Sign In for Pricing
View Details
Blender bag, 400ml x 70µm with full nylon filter, 300 x 190mm, pack of 500 (10 pack of 50)
IPD4400-B400F2 1 Each

Blender bag, 400ml x 70µm with full nylon filter, 300 x 190mm, pack of 500 (10 pack of 50)

Sign In for Pricing
View Details
Proteasome Activator Subunit 4 (PSME4) (NM_014614) Human Recombinant Protein
TP322965L 1 mg

Proteasome Activator Subunit 4 (PSME4) (NM_014614) Human Recombinant Protein

Sign In for Pricing
View Details
Sell Rat Monoclonal Antibody [Clone ID: MEL-14]
CL032RX 300 µg

Sell Rat Monoclonal Antibody [Clone ID: MEL-14]

Sign In for Pricing
View Details
Kynurenic Acid-d5
TRC-K660502-25MG 25 mg

Kynurenic Acid-d5

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS626803 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details