Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APRIL/TNFSF13 Trimer, Human (HEK293, His-Flag)

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Human (HEK293, His-Flag) is produced by HEK293 cells (K112-L250) with N-terminal His and Flag-tags.

Product Specifications

Product Name Alternative

APRIL/TNFSF13 Trimer Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Purity

98.0

Smiles

KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Molecular Formula

8741 (Gene_ID) O75888 (K112-L250) (Accession)

Molecular Weight

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-500 1x 500 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL
BNC940639-500 1x 500 µL

CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details