Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

18591 (Gene_ID) P31240 (S82-T190) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREBRF (NM_001168393) Human Over-expression Lysate
LS153222-20ug 20 µg

CREBRF (NM_001168393) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Ciliary Neurotrophic Factor, CNTF ELISA Kit
YLA0924RA-01 48 Tests

Rat Ciliary Neurotrophic Factor, CNTF ELISA Kit

Sign In for Pricing
View Details
Rat Ciliary Neurotrophic Factor, CNTF ELISA Kit
YLA0924RA-02 96 Tests

Rat Ciliary Neurotrophic Factor, CNTF ELISA Kit

Sign In for Pricing
View Details
Ssx2ip sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7249706 1.0 µg DNA

Ssx2ip sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DR6 Antibody
24077 100 µL

DR6 Antibody

Sign In for Pricing
View Details
FHL2 Rabbit monoclonal antibody
E43S40807 100 µL

FHL2 Rabbit monoclonal antibody

Sign In for Pricing
View Details