Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

18591 (Gene_ID) P31240 (S82-T190) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBEGF ELISA Kit (Mouse) (OKCD07422)
OKCD07422 96 Well

HBEGF ELISA Kit (Mouse) (OKCD07422)

Sign In for Pricing
View Details
Olfr390 (m) -PR
sc-150805-PR 10 µM - 20 µL

Olfr390 (m) -PR

Sign In for Pricing
View Details
RAI14 (NM_015577) Human Tagged Lenti ORF Clone
RC208689L1 10 µg

RAI14 (NM_015577) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
T179B Rabbit Polyclonal Antibody
JOT-AP05002-01 50ul

T179B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
T179B Rabbit Polyclonal Antibody
JOT-AP05002-02 100ul

T179B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Threonine--tRNA ligase (thrS)
MBS1040515-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Threonine--tRNA ligase (thrS)

Sign In for Pricing
View Details