Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

18591 (Gene_ID) P31240 (S82-T190) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

THK5351 (R enantiomer)
T39541 10 mg

THK5351 (R enantiomer)

Sign In for Pricing
View Details
Palmdelphin (PALMD) Porcine ELISA Kit
F6691 96 Tests

Palmdelphin (PALMD) Porcine ELISA Kit

Sign In for Pricing
View Details
Mouse SDK2 shRNA Plasmid
abx982323-01 150 µg

Mouse SDK2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SDK2 shRNA Plasmid
abx982323-02 300 µg

Mouse SDK2 shRNA Plasmid

Sign In for Pricing
View Details
Human STAT4 Antibody : PE (Phospho-Tyr693)
OAAQ00168-10T 10 Tests

Human STAT4 Antibody : PE (Phospho-Tyr693)

Sign In for Pricing
View Details
THOC6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV715834 1.0 µg DNA

THOC6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details