Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

18591 (Gene_ID) P31240 (S82-T190) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OS9 (NM_001017958) Human Recombinant Protein
E45H35582M5 20 µg

OS9 (NM_001017958) Human Recombinant Protein

Sign In for Pricing
View Details
Human soluble protein -100B ELISA Kit
GTR10362331 96 Well

Human soluble protein -100B ELISA Kit

Sign In for Pricing
View Details
SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI8C12]
CF809693 100 µg

SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI8C12]

Sign In for Pricing
View Details
N-desmethyl Binimetinib
CS-P-08734 1 Each

N-desmethyl Binimetinib

Sign In for Pricing
View Details
PG 931
B5807-1 1 mg

PG 931

Sign In for Pricing
View Details
E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5)
314222-01 50 µg

E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5)

Sign In for Pricing
View Details