Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Mouse (C-His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Mouse (C-His), Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

18591 (Gene_ID) P31240 (S82-T190) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1E Antibody
OAAF02280-100UG 100 µg

CSNK1E Antibody

Sign In for Pricing
View Details
Nf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4379607 1.0 µg DNA

Nf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Padi2-set siRNA/shRNA/RNAi Lentivector (Rat)
35926096 4x 500 ng

Padi2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Porcine AP-5 complex subunit beta (PP1030) ELISA Kit
MBS7217052-01 48 Well

Porcine AP-5 complex subunit beta (PP1030) ELISA Kit

Sign In for Pricing
View Details
Porcine AP-5 complex subunit beta (PP1030) ELISA Kit
MBS7217052-02 96 Well

Porcine AP-5 complex subunit beta (PP1030) ELISA Kit

Sign In for Pricing
View Details
Porcine AP-5 complex subunit beta (PP1030) ELISA Kit
MBS7217052-03 5x 96 Well

Porcine AP-5 complex subunit beta (PP1030) ELISA Kit

Sign In for Pricing
View Details