SGK2, Human (Active, sf9, GST)
Product Specifications
Product Name Alternative
SGK2 Protein, Human (Active, sf9, GST), Human, Sf9 insect cells
UNSPSC
12352202
Smiles
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Molecular Formula
10110 (Gene_ID) Q9HBY8-1 (N2-C367) (Accession)
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7221600-01 48 Well
Monkey Adenylyltransferase and sulfurtransferase MOCS3 (MOCS3) ELISA Kit
Sign In for Pricing
View Details 
MBS7221600-02 96 Well
Monkey Adenylyltransferase and sulfurtransferase MOCS3 (MOCS3) ELISA Kit
Sign In for Pricing
View Details MBS7221600-03 5x 96 Well
Monkey Adenylyltransferase and sulfurtransferase MOCS3 (MOCS3) ELISA Kit
Sign In for Pricing
View Details 
MBS7221600-04 10x 96 Well
Monkey Adenylyltransferase and sulfurtransferase MOCS3 (MOCS3) ELISA Kit
Sign In for Pricing
View Details