Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK3, Human (Active, sf9, His)

Product Specifications

Product Name Alternative

PLK3 Protein, Human (Active, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

RSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPA

Molecular Formula

1263 (Gene_ID) Q9H4B4 (R57-A340) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Ephrin-A3
E0302h 96 Tests

ELISA Kit For Ephrin-A3

Sign In for Pricing
View Details
Dysbindin (DTNBP1) (NM_001271669) Human Tagged ORF Clone
RC233741 10 µg

Dysbindin (DTNBP1) (NM_001271669) Human Tagged ORF Clone

Sign In for Pricing
View Details
FPGS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20806061 1.0 µg DNA

FPGS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RHBDD1 Antibody - C-terminal region : Biotin (ARP60503_P050-Biotin)
ARP60503_P050-Biotin 100 µL

RHBDD1 Antibody - C-terminal region : Biotin (ARP60503_P050-Biotin)

Sign In for Pricing
View Details
EED Human Pre-designed siRNA Set A
HY-RS04173 1 Set

EED Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
N-Dodecanoylglycine-d2
TRC-D494642-25MG 25 mg

N-Dodecanoylglycine-d2

Sign In for Pricing
View Details