Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK3, Human (Active, sf9, His)

Product Specifications

Product Name Alternative

PLK3 Protein, Human (Active, sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

RSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPA

Molecular Formula

1263 (Gene_ID) Q9H4B4 (R57-A340) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Gonadotropin Releasing Hormone GnRH ELISA Kit
BG-BVN11116 1 Each

Bovine Gonadotropin Releasing Hormone GnRH ELISA Kit

Sign In for Pricing
View Details
Psma4 AAV siRNA Pooled Vector
37943166 1.0 µg

Psma4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MA3 Lentiviral Activation Particles (m2)
sc-434135-LAC-2 200 µL

MA3 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ZFHX2 Protein Lysate (Rat) with C-HA Tag
50828036 100 µg

ZFHX2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ABCB10P1 Recombinant Protein (Human)
RP045484 100 µg

ABCB10P1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Monkey Regulated On Activation In Normal T-Cell Expressed And Secreted ELISA Kit
MBS736560-01 48 Well

Monkey Regulated On Activation In Normal T-Cell Expressed And Secreted ELISA Kit

Sign In for Pricing
View Details