Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNT1, Sheep (P. pastoris, His)

Product Specifications

Product Name Alternative

IFNT1 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Smiles

CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP

Molecular Formula

100144750 (Gene_ID) P56828 (C24-P195) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Docusate sodium
T0929-01 50 mg

Docusate sodium

Sign In for Pricing
View Details
Docusate sodium
T0929-02 1 mL - 10 mM (in DMSO)

Docusate sodium

Sign In for Pricing
View Details
Docusate sodium
T0929-03 100 mg

Docusate sodium

Sign In for Pricing
View Details
Docusate sodium
T0929-04 200 mg

Docusate sodium

Sign In for Pricing
View Details
Docusate sodium
T0929-05 500 mg

Docusate sodium

Sign In for Pricing
View Details
Interleukin 1 beta, Recombinant, Human
MBS650145-01 0.01 mg

Interleukin 1 beta, Recombinant, Human

Sign In for Pricing
View Details