Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNT1, Sheep (P. pastoris, His)

Product Specifications

Product Name Alternative

IFNT1 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Smiles

CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP

Molecular Formula

100144750 (Gene_ID) P56828 (C24-P195) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ig Kappa Chain Rabbit mAb
A19720-01 20 µL

Human Ig Kappa Chain Rabbit mAb

Sign In for Pricing
View Details
Human Ig Kappa Chain Rabbit mAb
A19720-02 100 μL

Human Ig Kappa Chain Rabbit mAb

Sign In for Pricing
View Details
Human Ig Kappa Chain Rabbit mAb
A19720-03 500 μL

Human Ig Kappa Chain Rabbit mAb

Sign In for Pricing
View Details
Human Ig Kappa Chain Rabbit mAb
A19720-04 1000 μL

Human Ig Kappa Chain Rabbit mAb

Sign In for Pricing
View Details
Human DUSP1 Pre-designed siRNA Set A
SI004613A 1 Each

Human DUSP1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant human LH Alpha / Beta Heterodimer protein, C-His (HEK293), APC Conjugated
bs-43083P-APC-01 20 µg

Recombinant human LH Alpha / Beta Heterodimer protein, C-His (HEK293), APC Conjugated

Sign In for Pricing
View Details