Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Cynomolgus (HEK293, His)

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Smiles

YSHWPSCCPSKGYPSEELLRWSTVPVPPLKPASLDFHSVSCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGKKGNHKGYCLERRLYRVSLACVCVRPRVMG

Molecular Formula

102115667 (Gene_ID) G7P9V9 (Y33-G176) (Accession)

Molecular Weight

Approximately 27-37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF647 conjugate, 0.1mg/mL
BNC470735-100 1x 100 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
BNC400949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details