CEACAM7, Human (207a.a, HEK293, His)
Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain.
Product Specifications
Product Name Alternative
CEACAM7 Protein, Human (207a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Molecular Formula
1087 (Gene_ID) Q14002-1 (T36-S242) (Accession)
Molecular Weight
Approximately 45-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
