GDF-8, Human/Mouse/Rat (HEK293, Fc)
Product Specifications
UNSPSC Description
The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-8-protein-mouse-hek293-fc.html
Purity
97.00
Smiles
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740723-100 1x 100 µL
P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details