GDF-8, Human/Mouse/Rat (HEK293, Fc)
Selected Variant
HY-P74127-01
Size: 5 µg
Product Specifications
UNSPSC Description
The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-8-protein-mouse-hek293-fc.html
Purity
97.00
Smiles
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680698-100 1x 100 µL
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040803-100 1x 100 µL
Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC063442-500 1x 500 µL
CD81 / TAPA-1 (rC81/3442), CF405L conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881540-500 1x 500 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882353-100 1x 100 µL
Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401813-500 1x 500 µL
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details