GDF-8, Human/Mouse/Rat (HEK293, Fc)
Product Specifications
UNSPSC Description
The GDF-8 protein, also known as myostatin, negatively regulates skeletal muscle growth.It acts as a disulfide-linked homodimer and inhibits its activity by interacting with WFIKKN2.Additionally, it interacts with FSTL3. GDF-8 Protein, Human/Mouse/Rat (HEK293, Fc) is the recombinant mouse-derived GDF-8 protein, expressed by HEK293 , with N-hFc labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-8-protein-mouse-hek293-fc.html
Purity
97.00
Smiles
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Weight
Approximately 40 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400281-500 1x 500 µL
Insulin (E2-E3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details