Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ifi30, Mouse (His)

Product Specifications

Product Name Alternative

Ifi30 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

94

Smiles

PSPPVRVSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTE

Molecular Formula

(Gene_ID) Q9ESY9 (P55-E230) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-01 10 µg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-02 50 µg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-03 100 µg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-04 200 µg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-05 500 µg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Recombinant Melanoma Antigen Family A3 (MAGEA3)
TRV-0054420-06 1 mg

Recombinant Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details