Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ifi30, Mouse (His)

Product Specifications

Product Name Alternative

Ifi30 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

94

Smiles

PSPPVRVSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTE

Molecular Formula

(Gene_ID) Q9ESY9 (P55-E230) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL
BNCB2886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2910), 0.2mg/mL
BNUB2910-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2910), 0.2mg/mL

Sign In for Pricing
View Details
Human NRP2 Antibody Pair Set
E-KAB-0187 50 µL & 100 µg

Human NRP2 Antibody Pair Set

Sign In for Pricing
View Details
APC Anti-Human CD64 Antibody[10.1]
E-AB-F1082E-01 20 Tests

APC Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details