Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf15 3'UTR Luciferase Stable Cell Line
TU003109 1.0 mL

C18orf15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Olfactory receptor 2T6 OR2T6 Antibody
A17763 100 µL

Anti-Olfactory receptor 2T6 OR2T6 Antibody

Sign In for Pricing
View Details
Compound NP-018351
MBS5794259 Inquire

Compound NP-018351

Sign In for Pricing
View Details
LAMC1 Peptide - middle region (AAP58234)
AAP58234-100UG 100 µg

LAMC1 Peptide - middle region (AAP58234)

Sign In for Pricing
View Details
LCP2
484675 100 µL

LCP2

Sign In for Pricing
View Details
ZNF275 (Zinc Finger Protein 275)
496339 100 µL

ZNF275 (Zinc Finger Protein 275)

Sign In for Pricing
View Details