Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKP (C-term) Rabbit Polyclonal Antibody
AP15111PU-N 400 µL

PFKP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MDM2 Antibody
F42269-0.08ML 0.08 mL

MDM2 Antibody

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-01 60 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-02 120 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-03 200 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details
2-Chlorodibenzo[b,f][1,4]thiazepin-11(10H)-one
TRC-C363795-50MG 50 mg

2-Chlorodibenzo[b,f][1,4]thiazepin-11(10H)-one

Sign In for Pricing
View Details