Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020518-01 50 Tests

Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020518-02 100 Tests

Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
TRV-0020518-03 200 Tests

Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody

Sign In for Pricing
View Details
TMPRSS4, Control Peptide (Transmembrane Protease Serine 4, Channel-activating Protease 2, CAPH2, Membrane-type Serine Protease 2, MT-SP2, TMPRSS3, UNQ776/PRO1570)
148980 100 µg

TMPRSS4, Control Peptide (Transmembrane Protease Serine 4, Channel-activating Protease 2, CAPH2, Membrane-type Serine Protease 2, MT-SP2, TMPRSS3, UNQ776/PRO1570)

Sign In for Pricing
View Details
CHM Polyclonal Antibody, HRP Conjugated
A62267-100 100 µL

CHM Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Xenopus laevis Transmembrane protein 178 (tmem178), partial
MBS7057561 Inquire

Recombinant Xenopus laevis Transmembrane protein 178 (tmem178), partial

Sign In for Pricing
View Details