Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pOTB7-BRK1 Plasmid
PVT26599 2 µg

pOTB7-BRK1 Plasmid

Ask
View Details
IFITM5 Human Pre-designed siRNA Set A
HY-RS06569 1 Set

IFITM5 Human Pre-designed siRNA Set A

Ask
View Details
Sheep Pancreatic Polypeptide ELISA Kit
MBS737083-01 48 Well

Sheep Pancreatic Polypeptide ELISA Kit

Ask
View Details
Sheep Pancreatic Polypeptide ELISA Kit
MBS737083-02 96 Well

Sheep Pancreatic Polypeptide ELISA Kit

Ask
View Details
Sheep Pancreatic Polypeptide ELISA Kit
MBS737083-03 5x 96 Well

Sheep Pancreatic Polypeptide ELISA Kit

Ask
View Details
Sheep Pancreatic Polypeptide ELISA Kit
MBS737083-04 10x 96 Well

Sheep Pancreatic Polypeptide ELISA Kit

Ask
View Details