Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK1904529A
sc-507398 10 mg

GSK1904529A

Sign In for Pricing
View Details
Cardiotoxin Analog (CTX) IV (6-12) 1mg
A22358-1 1 mg

Cardiotoxin Analog (CTX) IV (6-12) 1mg

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) crp79 Polyclonal Antibody
MBS9012986 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) crp79 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rickettsia felis Chaperone protein ClpB (clpB), partial
MBS1316312 Inquire

Recombinant Rickettsia felis Chaperone protein ClpB (clpB), partial

Sign In for Pricing
View Details
PLEKHG5 Rabbit Polyclonal Antibody (BF647)
orb2534259 100 µL

PLEKHG5 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Nori® Donkey FGFa ELISA Kit
GR170099 96 Well

Nori® Donkey FGFa ELISA Kit

Sign In for Pricing
View Details