Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NatureTip 100μL Filtered Pipet Tip
BHZ07R1W-FS 100 µL

NatureTip 100μL Filtered Pipet Tip

Ask
View Details
Lentiviral human OS9 shRNA (UAS) - Lentiviral human OS9 shRNA (UAS) plasmid
GTR15115051 1 Vial

Lentiviral human OS9 shRNA (UAS) - Lentiviral human OS9 shRNA (UAS) plasmid

Ask
View Details
Rat Cyclin D (CD) ELISA Kit
SL1877Ra-01 48 Tests

Rat Cyclin D (CD) ELISA Kit

Ask
View Details
Rat Cyclin D (CD) ELISA Kit
SL1877Ra-02 96 Tests

Rat Cyclin D (CD) ELISA Kit

Ask
View Details
Fish Testican 1 (SPOCK1) ELISA Kit
MBS9355642 Inquire

Fish Testican 1 (SPOCK1) ELISA Kit

Ask
View Details
Rmnd1 3'UTR Lenti-reporter-Luc Vector
39635086 1.0 µg

Rmnd1 3'UTR Lenti-reporter-Luc Vector

Ask
View Details