Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETFR-2/TEAD-4, Mouse (His)

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with His tag.

Product Specifications

Product Name Alternative

ETFR-2/TEAD-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Purity

91

Smiles

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

21679 (Gene_ID) Q62296-1 (R210-E427) (Accession)

Molecular Weight

Approximately 32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (FITC)
125209-FITC 100 µL

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (FITC)

Sign In for Pricing
View Details
BRMS1 shRNA Plasmid (h)
sc-60290-SH 20 µg

BRMS1 shRNA Plasmid (h)

Sign In for Pricing
View Details
ZNF205 Blocking Peptide
33R-7354 100 ug

ZNF205 Blocking Peptide

Sign In for Pricing
View Details
PUS7 Rabbit Polyclonal Antibody (Biotin)
orb2116972 100 µL

PUS7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
2',4',5',7'-Tetrabromo-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carboxylic acid
OR1067698-01 50 mg

2',4',5',7'-Tetrabromo-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carboxylic acid

Sign In for Pricing
View Details
2',4',5',7'-Tetrabromo-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carboxylic acid
OR1067698-02 100 mg

2',4',5',7'-Tetrabromo-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carboxylic acid

Sign In for Pricing
View Details