Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLC2E, Mouse (HEK293, Fc)

Product Specifications

Product Name Alternative

CLC2E Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Smiles

VRKKKPVMESCEPCYAVCSSGWIGFGNKCFYFSEDMGNWTFSQSSCIALDAHLALFDSLEELNFLKRYKGASDHWIGLHRESSEHPWIWTDNTEYNNLVLTRGGGECAYLSNRGIYNSSGDIHKKWICNKPNNYTLQRPLIVNPG

Molecular Formula

/ (Gene_ID) Q80XD9 (V60-G204) (Accession)

Molecular Weight

Approximately 53-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ulex europaeus Lectin (UEA II) - Macrobeads
21511206-1 10 mL

Ulex europaeus Lectin (UEA II) - Macrobeads

Ask
View Details
SRP19 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62502R-BF488-01 20 µL

SRP19 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
SRP19 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62502R-BF488-02 100 µL

SRP19 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit
MBS7204482-01 48 Well

Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit

Ask
View Details
Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit
MBS7204482-02 96 Well

Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit

Ask
View Details
Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit
MBS7204482-03 5x 96 Well

Guinea pig Adenylate kinase domain-containing protein 1 (AKD1) ELISA Kit

Ask
View Details