Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFTPA1, Human (His)

Product Specifications

Product Name Alternative

SFTPA1 Protein, Human (His), Human, HEK293

UNSPSC

12352202

Purity

97

Smiles

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Molecular Formula

653509 (Gene_ID) Q8IWL2 (E21-F248) (Accession)

Molecular Weight

Approximately 54-66 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV760416 1.0 µg DNA

EEF1A1P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
AH 18801
T29733-01 25 mg

AH 18801

Sign In for Pricing
View Details
AH 18801
T29733-02 50 mg

AH 18801

Sign In for Pricing
View Details
AH 18801
T29733-03 100 mg

AH 18801

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe nup45 Protein (aa 1-425)
VAng-Yyj6333-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe nup45 Protein (aa 1-425)

Sign In for Pricing
View Details
Zfp352 Protein Vector (Mouse) (pPM-C-His)
PV249297 500 ng

Zfp352 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details