What is the catalog number for SFTPA1, Human (His)?

The catalog number for SFTPA1, Human (His) is HY-P705479.

What sizes are available for SFTPA1, Human (His)?

SFTPA1, Human (His) is available in the following size(s): 20 µg, 50 µg, 100 µg.

How many pack sizes does SFTPA1, Human (His) come in?

SFTPA1, Human (His) is available in 3 different pack sizes.

Is SFTPA1, Human (His) in stock?

SFTPA1, Human (His) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures SFTPA1, Human (His)?

SFTPA1, Human (His) is manufactured by QuantiMol.

What is the estimated delivery time for SFTPA1, Human (His)?

Estimated delivery time for SFTPA1, Human (His) is approximately 15 business day(s), depending on your location.

SFTPA1, Human (His)

Product Specifications

Product Name Alternative

SFTPA1 Protein, Human (His), Human, HEK293

UNSPSC

12352202

Purity

97

Smiles

EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Molecular Formula

653509 (Gene_ID) Q8IWL2 (E21-F248) (Accession)

Molecular Weight

Approximately 54-66 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hAP-0737 50 µg

Mouse Monoclonal anti-human Fgr

Sign In for Pricing

View Details

GTR15206211 1 Vial

Lentiviral mouse Retn shRNA (UAS) - Lentiviral mouse Retn shRNA (UAS, iRFP) (100)

Sign In for Pricing

View Details

TA381811 100 µL

SNAIL (SNAI1) Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

AVARP00033_T100-HRP 100 µL

TNFRSF11B Antibody - N-terminal region : HRP (AVARP00033_T100-HRP)

Sign In for Pricing

View Details

40300166-1 500 mg

Cholecalciferol

Sign In for Pricing

View Details

253713 100 µg

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12)

Sign In for Pricing

View Details