Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ferredoxin-1, Human (His, Myc)

Product Specifications

Product Name Alternative

Ferredoxin-1 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Purity

92

Smiles

SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Molecular Formula

2230 (Gene_ID) P10109 (S61-S184) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDHE1A, phosphorylated (S232) (PDHA1, PHE1A, Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial, PDHE1-A type I) (MaxLight 750) discontinued
039833-ML750 100 µL

PDHE1A, phosphorylated (S232) (PDHA1, PHE1A, Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial, PDHE1-A type I) (MaxLight 750) discontinued

Sign In for Pricing
View Details
(βS) -3-[ (1S) -1-Amino-2-hydroxyethyl]-β-[[[ethyl (phenylmethyl) amino]carbonyl]amino]-1,2,4-oxadiazole-5-propanamide
469783-01 1 mg

(βS) -3-[ (1S) -1-Amino-2-hydroxyethyl]-β-[[[ethyl (phenylmethyl) amino]carbonyl]amino]-1,2,4-oxadiazole-5-propanamide

Sign In for Pricing
View Details
(βS) -3-[ (1S) -1-Amino-2-hydroxyethyl]-β-[[[ethyl (phenylmethyl) amino]carbonyl]amino]-1,2,4-oxadiazole-5-propanamide
469783-02 2.5 mg

(βS) -3-[ (1S) -1-Amino-2-hydroxyethyl]-β-[[[ethyl (phenylmethyl) amino]carbonyl]amino]-1,2,4-oxadiazole-5-propanamide

Sign In for Pricing
View Details
1700019A02Rik ORF Vector (Mouse) (pORF)
ORF036739 1.0 µg DNA

1700019A02Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ADNP2 (Adnp2 Protein EMBL AAI66606.1)
474808 100 µL

ADNP2 (Adnp2 Protein EMBL AAI66606.1)

Sign In for Pricing
View Details
Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein
abx680207-01 10 µg

Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein

Sign In for Pricing
View Details