Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ferredoxin-1, Human (His, Myc)

Product Specifications

Product Name Alternative

Ferredoxin-1 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Purity

92

Smiles

SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Molecular Formula

2230 (Gene_ID) P10109 (S61-S184) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD48 (APC) discontinued
516402-01 50 Tests

CD48 (APC) discontinued

Sign In for Pricing
View Details
CD48 (APC) discontinued
516402-02 100 Tests

CD48 (APC) discontinued

Sign In for Pricing
View Details
CD48 (APC) discontinued
516402-03 500 Tests

CD48 (APC) discontinued

Sign In for Pricing
View Details
EDA-GTP-DY-480Xl
NU-820-480Xl 40 µL

EDA-GTP-DY-480Xl

Sign In for Pricing
View Details
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-associated Mucin, CD227, PUM) (MaxLight 550)
138146-ML550 100 µL

MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-associated Mucin, CD227, PUM) (MaxLight 550)

Sign In for Pricing
View Details
CD3 (AB5299) Mouse mAb IHC Kit
KV0524-01 3 mL

CD3 (AB5299) Mouse mAb IHC Kit

Sign In for Pricing
View Details